CHCHD4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13139T
Artikelname: CHCHD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13139T
Hersteller Artikelnummer: CNA13139T
Alternativnummer: MBL-CNA13139T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human CHCHD4 (NP_001091972.1).
Konjugation: Unconjugated
Alternative Synonym: MIA40, TIMM40
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 131474
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Target-Kategorie: CHCHD4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200