FMN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13143T
Artikelname: FMN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13143T
Hersteller Artikelnummer: CNA13143T
Alternativnummer: MBL-CNA13143T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1).
Konjugation: Unconjugated
Alternative Synonym: LD, FMN
Klonalität: Polyclonal
Molekulargewicht: 158kDa
NCBI: 342184
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NIDMPKTEPKGADPESPRREEMGCNADQESQSGPGVPQTQGGEVKPKSPETALEAFKALFIRPPRKGTTADTSELEALKRKMRHEKESLRAVFERSNSKPADGPSDSKSPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYT
Target-Kategorie: FMN1
Application Verdünnung: WB: WB,1:500 - 1:2000