RBM14 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13159T
Artikelname: RBM14 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13159T
Hersteller Artikelnummer: CNA13159T
Alternativnummer: MBL-CNA13159T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).
Konjugation: Unconjugated
Alternative Synonym: SIP, COAA, PSP2, SYTIP1, TMEM137
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 10432
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Target-Kategorie: RBM14
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500