PARVB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13161T
Artikelname: PARVB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13161T
Hersteller Artikelnummer: CNA13161T
Alternativnummer: MBL-CNA13161T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PARVB (NP_037459.2).
Konjugation: Unconjugated
Alternative Synonym: CGI-56
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 29780
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDV
Target-Kategorie: PARVB
Application Verdünnung: WB: WB,1:500 - 1:2000