U2AF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13166T
Artikelname: U2AF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13166T
Hersteller Artikelnummer: CNA13166T
Alternativnummer: MBL-CNA13166T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Konjugation: Unconjugated
Alternative Synonym: RN, FP793, U2AF35, U2AFBP, RNU2AF1
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 7307
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Target-Kategorie: U2AF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IP,1:500 - 1:1000