SREK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13235T
Artikelname: SREK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13235T
Hersteller Artikelnummer: CNA13235T
Alternativnummer: MBL-CNA13235T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1).
Konjugation: Unconjugated
Alternative Synonym: SFRS12, SRrp86, SRrp508
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 140890
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
Target-Kategorie: SREK1
Application Verdünnung: WB: WB,1:500 - 1:2000