PAPD4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13238T
Artikelname: PAPD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13238T
Hersteller Artikelnummer: CNA13238T
Alternativnummer: MBL-CNA13238T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PAPD4 (NP_776158.2).
Konjugation: Unconjugated
Alternative Synonym: APD4, GLD2, TUT2, PAPD4
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 167153
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASPLFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYI
Target-Kategorie: TENT2
Application Verdünnung: WB: WB,1:500 - 1:2000