TBCB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13248T
Artikelname: TBCB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13248T
Hersteller Artikelnummer: CNA13248T
Alternativnummer: MBL-CNA13248T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human TBCB (NP_001272.2).
Konjugation: Unconjugated
Alternative Synonym: CG22, CKAP1, CKAPI
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 1155
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Target-Kategorie: TBCB
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200