Podoplanin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13261P
Artikelname: Podoplanin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13261P
Hersteller Artikelnummer: CNA13261P
Alternativnummer: MBL-CNA13261P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 99-199 of human Podoplanin (NP_006465.3).
Konjugation: Unconjugated
Alternative Synonym: T1A, GP36, GP40, Gp38, OTS8, T1A2, TI1A, D2-40, T1A-2, AGGRUS, HT1A-1, PA2.26
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 10630
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
Target-Kategorie: PDPN
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200