SFRS9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13265T
Artikelname: SFRS9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13265T
Hersteller Artikelnummer: CNA13265T
Alternativnummer: MBL-CNA13265T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Konjugation: Unconjugated
Alternative Synonym: SFRS9, SRp30c
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 8683
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Target-Kategorie: SRSF9
Application Verdünnung: WB: WB,1:500 - 1:2000