DDX5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13294S
Artikelname: DDX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13294S
Hersteller Artikelnummer: CNA13294S
Alternativnummer: MBL-CNA13294S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-614 of human DDX5 (NP_004387.1).
Konjugation: Unconjugated
Alternative Synonym: p68, HLR1, G17P1, HUMP68
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 1655
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRML
Target-Kategorie: DDX5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200