Desmoplakin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13299S
Artikelname: Desmoplakin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13299S
Hersteller Artikelnummer: CNA13299S
Alternativnummer: MBL-CNA13299S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2750-2850 of human Desmoplakin (NP_004406.2).
Konjugation: Unconjugated
Alternative Synonym: DP, DCWHKTA
Klonalität: Polyclonal
Molekulargewicht: 332kDa
NCBI: 1832
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSF
Target-Kategorie: DSP
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200