Pin1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13665S
Artikelname: Pin1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13665S
Hersteller Artikelnummer: CNA13665S
Alternativnummer: MBL-CNA13665S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human Pin1 (NP_006212.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 5300
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Target-Kategorie: PIN1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200