[KO Validated] PMS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13680S
Artikelname: [KO Validated] PMS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13680S
Hersteller Artikelnummer: CNA13680S
Alternativnummer: MBL-CNA13680S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 390-670 of human PMS2 (NP_000526.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 96kDa
NCBI: 5395
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAPKTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDMSASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQ
Target-Kategorie: PMS2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50