CAST Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13683S
Artikelname: CAST Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13683S
Hersteller Artikelnummer: CNA13683S
Alternativnummer: MBL-CNA13683S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human CAST (NP_001177371.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 831
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPS
Target-Kategorie: CAST
Application Verdünnung: WB: WB,1:500 - 1:2000