PDHA1 Rabbit mAb, Clone: [ARC0722], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA13687S
Artikelname: PDHA1 Rabbit mAb, Clone: [ARC0722], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA13687S
Hersteller Artikelnummer: CNA13687S
Alternativnummer: MBL-CNA13687S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PDHA1 (P08559).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0722]
Molekulargewicht: 43kDa
NCBI: 5160
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG
Target-Kategorie: PDHA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200