TNFAIP8L2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13698T
Artikelname: TNFAIP8L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13698T
Hersteller Artikelnummer: CNA13698T
Alternativnummer: MBL-CNA13698T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 79626
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Target-Kategorie: TNFAIP8L2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000