RND1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13705T
Artikelname: RND1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13705T
Hersteller Artikelnummer: CNA13705T
Alternativnummer: MBL-CNA13705T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-232 of human RND1 (NP_055285.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 27289
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Target-Kategorie: RND1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200