GNA12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13740T
Artikelname: GNA12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13740T
Hersteller Artikelnummer: CNA13740T
Alternativnummer: MBL-CNA13740T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 285-381 of human GNA12 (NP_031379.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 2768
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ
Target-Kategorie: GNA12
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200