IDH3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13742T
Artikelname: IDH3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13742T
Hersteller Artikelnummer: CNA13742T
Alternativnummer: MBL-CNA13742T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 3420
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE
Target-Kategorie: IDH3B
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100