Myeloperoxidase (MPO) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1374P
Artikelname: Myeloperoxidase (MPO) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1374P
Hersteller Artikelnummer: CNA1374P
Alternativnummer: MBL-CNA1374P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 646-745 of human Myeloperoxidase (MPO) (NP_000241.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 4353
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Target-Kategorie: MPO
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200