CMAS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13752T
Artikelname: CMAS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13752T
Hersteller Artikelnummer: CNA13752T
Alternativnummer: MBL-CNA13752T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 55907
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDW
Target-Kategorie: CMAS
Application Verdünnung: WB: WB,1:500 - 1:2000