HSF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13765T
Artikelname: HSF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13765T
Hersteller Artikelnummer: CNA13765T
Alternativnummer: MBL-CNA13765T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-529 of human HSF1 (NP_005517.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 3297
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Target-Kategorie: HSF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100