SULF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13797T
Artikelname: SULF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13797T
Hersteller Artikelnummer: CNA13797T
Alternativnummer: MBL-CNA13797T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 480-610 of human SULF1 (NP_001121676.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 101kDa
NCBI: 23213
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SDLLTVRQSTRNLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLEEEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPT
Target-Kategorie: SULF1
Application Verdünnung: WB: WB,1:500 - 1:2000