GRIK4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13800T
Artikelname: GRIK4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13800T
Hersteller Artikelnummer: CNA13800T
Alternativnummer: MBL-CNA13800T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 2900
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN
Target-Kategorie: GRIK4
Application Verdünnung: WB: WB,1:500 - 1:2000