FCRL5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13803T
Artikelname: FCRL5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13803T
Hersteller Artikelnummer: CNA13803T
Alternativnummer: MBL-CNA13803T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-190 of human FCRL5 (NP_001182317.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 106kDa
NCBI: 83416
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFT
Target-Kategorie: FCRL5
Application Verdünnung: WB: WB,1:500 - 1:2000