PSME4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13815T
Artikelname: PSME4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13815T
Hersteller Artikelnummer: CNA13815T
Alternativnummer: MBL-CNA13815T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1634-1843 of human PSME4 (NP_055429.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 211kDa
NCBI: 23198
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
Target-Kategorie: PSME4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200