[KO Validated] NDUFB4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13820T
Artikelname: [KO Validated] NDUFB4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13820T
Hersteller Artikelnummer: CNA13820T
Alternativnummer: MBL-CNA13820T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 4710
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG
Target-Kategorie: NDUFB4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100