ARPC2 Rabbit mAb, Clone: [ARC2558], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1382S
Artikelname: ARPC2 Rabbit mAb, Clone: [ARC2558], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1382S
Hersteller Artikelnummer: CNA1382S
Alternativnummer: MBL-CNA1382S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2558]
Molekulargewicht: 34kDa
NCBI: 10109
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Target-Kategorie: ARPC2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200