CRACR2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13839T
Artikelname: CRACR2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13839T
Hersteller Artikelnummer: CNA13839T
Alternativnummer: MBL-CNA13839T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 84766
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDF
Target-Kategorie: CRACR2A
Application Verdünnung: WB: WB,1:500 - 1:2000