NOXA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13844T
Artikelname: NOXA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13844T
Hersteller Artikelnummer: CNA13844T
Alternativnummer: MBL-CNA13844T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-300 of human NOXA1 (NP_006638.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 10811
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
Target-Kategorie: NOXA1
Application Verdünnung: WB: WB,1:1000 - 1:5000