CSAD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13845T
Artikelname: CSAD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13845T
Hersteller Artikelnummer: CNA13845T
Alternativnummer: MBL-CNA13845T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 51380
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL
Target-Kategorie: CSAD
Application Verdünnung: WB: WB,1:2000 - 1:6000