ETV4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13860T
Artikelname: ETV4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13860T
Hersteller Artikelnummer: CNA13860T
Alternativnummer: MBL-CNA13860T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 2118
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYL
Target-Kategorie: ETV4
Application Verdünnung: WB: WB,1:500 - 1:1000