PLA2G7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13864T
Artikelname: PLA2G7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13864T
Hersteller Artikelnummer: CNA13864T
Alternativnummer: MBL-CNA13864T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 7941
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
Target-Kategorie: PLA2G7
Application Verdünnung: WB: WB,1:500 - 1:2000