RNASEH2C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13884T
Artikelname: RNASEH2C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13884T
Hersteller Artikelnummer: CNA13884T
Alternativnummer: MBL-CNA13884T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human RNASEH2C (NP_115569.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 84153
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
Target-Kategorie: RNASEH2C
Application Verdünnung: WB: WB,1:500 - 1:2000