DYNLL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13889T
Artikelname: DYNLL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13889T
Hersteller Artikelnummer: CNA13889T
Alternativnummer: MBL-CNA13889T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 140735
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Target-Kategorie: DYNLL2
Application Verdünnung: WB: WB,1:500 - 1:2000