FCGR2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1388P
Artikelname: FCGR2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1388P
Hersteller Artikelnummer: CNA1388P
Alternativnummer: MBL-CNA1388P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR2A (NP_001129691.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 2212
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKP
Target-Kategorie: FCGR2A
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200