UBE2E1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA13912T
| Artikelname: |
UBE2E1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA13912T |
| Hersteller Artikelnummer: |
CNA13912T |
| Alternativnummer: |
MBL-CNA13912T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-50 of human UBE2E1 (NP_003332.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
21kDa |
| NCBI: |
7324 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAK |
| Target-Kategorie: |
UBE2E1 |
| Application Verdünnung: |
WB: WB,1:200 - 1:2000 |
