Sin3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13928S
Artikelname: Sin3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13928S
Hersteller Artikelnummer: CNA13928S
Alternativnummer: MBL-CNA13928S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Sin3A (NP_056292.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 145kDa
NCBI: 25942
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
Target-Kategorie: SIN3A
Application Verdünnung: WB: WB,1:500 - 1:2000