[KO Validated] RBBP4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13934S
Artikelname: [KO Validated] RBBP4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13934S
Hersteller Artikelnummer: CNA13934S
Alternativnummer: MBL-CNA13934S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-425 of human RBBP4 (NP_005601.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 5928
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMI
Target-Kategorie: RBBP4
Application Verdünnung: WB: WB,1:500 - 1:1000|ChIP,1:20 - 1:50