CBP80 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13939S
Artikelname: CBP80 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13939S
Hersteller Artikelnummer: CNA13939S
Alternativnummer: MBL-CNA13939S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CBP80 (NP_002477.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 4686
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNF
Target-Kategorie: NCBP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200