COMP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13963S
Artikelname: COMP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13963S
Hersteller Artikelnummer: CNA13963S
Alternativnummer: MBL-CNA13963S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 1311
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG
Target-Kategorie: COMP
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200