CYP17A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13968S
Artikelname: CYP17A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13968S
Hersteller Artikelnummer: CNA13968S
Alternativnummer: MBL-CNA13968S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 209-508 of human CYP17A1 (NP_000093.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 1586
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQR
Target-Kategorie: CYP17A1
Application Verdünnung: WB: WB,1:500 - 1:2000