PLAUR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1397S
Artikelname: PLAUR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1397S
Hersteller Artikelnummer: CNA1397S
Alternativnummer: MBL-CNA1397S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-305 of human PLAUR (NP_002650.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 5329
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGD
Target-Kategorie: PLAUR
Application Verdünnung: WB: WB,1:500 - 1:1000