Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13988S
Artikelname: Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13988S
Hersteller Artikelnummer: CNA13988S
Alternativnummer: MBL-CNA13988S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 2719
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQAT
Target-Kategorie: GPC3
Application Verdünnung: WB: WB,1:500 - 1:2000