KCNJ4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14010S
Artikelname: KCNJ4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14010S
Hersteller Artikelnummer: CNA14010S
Alternativnummer: MBL-CNA14010S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 3761
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: CVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAV
Target-Kategorie: KCNJ4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200