PDHA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14038S
Artikelname: PDHA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14038S
Hersteller Artikelnummer: CNA14038S
Alternativnummer: MBL-CNA14038S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 119-388 of human PDHA2 (NP_005381.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 5161
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSS
Target-Kategorie: PDHA2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100