PLOD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14044S
Artikelname: PLOD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14044S
Hersteller Artikelnummer: CNA14044S
Alternativnummer: MBL-CNA14044S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-727 of human PLOD1 (NP_000293.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 5351
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTIDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYIAVSFVDP
Target-Kategorie: PLOD1
Application Verdünnung: WB: WB,1:500 - 1:2000