PTPN22 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1406T
Artikelname: PTPN22 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1406T
Hersteller Artikelnummer: CNA1406T
Alternativnummer: MBL-CNA1406T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PTPN22 (NP_036543.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 26191
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFI
Target-Kategorie: PTPN22
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200