BEST1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14070S
Artikelname: BEST1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14070S
Hersteller Artikelnummer: CNA14070S
Alternativnummer: MBL-CNA14070S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 376-585 of human BEST1 (NP_004174.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 7439
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS
Target-Kategorie: BEST1
Application Verdünnung: WB: WB,1:500 - 1:2000